PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aradu.1DV6R
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Dalbergieae; Arachis
Family MYB_related
Protein Properties Length: 302aa    MW: 34319.9 Da    PI: 6.3935
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Aradu.1DV6RgenomeNCGR_PGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding56.27.9e-18552148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     rg+WT +Ed+ l+++++ +G g+W++ ar  g++Rt+k+c++rw++yl
      Aradu.1DV6R  5 RGPWTVDEDLTLINYIANHGEGRWNSLARSAGLKRTGKSCRLRWLNYL 52
                     89********************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129425.461156IPR017930Myb domain
SuperFamilySSF466893.44E-22288IPR009057Homeodomain-like
SMARTSM007173.0E-14454IPR001005SANT/Myb domain
PfamPF002492.1E-16552IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.0E-22659IPR009057Homeodomain-like
CDDcd001673.46E-11752No hitNo description
PROSITE profilePS500904.57753120IPR017877Myb-like domain
SMARTSM007170.715794IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.607.2E-86095IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 302 aa     Download sequence    Send to blast
MELRRGPWTV DEDLTLINYI ANHGEGRWNS LARSAGLKRT GKSCRLRWLN YLRPDVRRGN  60
ITLEEQLLIL ELHASWGNRT DNEIKNYWRT RVQKHAKQLK CDVNSKQFKD TMRFLWMPRL  120
VERIQAAAAT VTTAATATSD SPTLSATKSV TIINNNNTTT AYNFDNLNNL EVHSGNIMNM  180
SNNNFGYATP ENSSTGTSSD SFVTQDYCNN NNNNVHVGNN NNNNEPSSDY YHQQGNNNNQ  240
VSFMDCITSP SSMSLFPHQE MDFQAMELPN TPWINNPSTF SNFWNDENML LLQNLGCGGD  300
NM
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C1e-1528824120MYB TRANSFORMING PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015959466.10.0PREDICTED: transcription factor MYB108-like
SwissprotQ9LDE15e-71MY108_ARATH; Transcription factor MYB108
TrEMBLA0A151QND21e-109A0A151QND2_CAJCA; Myb-related protein 305 family
STRINGGLYMA09G03690.11e-100(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF2871422
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G49620.19e-70myb domain protein 78